compare

Comparison List

You must be logged in to submit a new spectrum

mTFP0.4

mTFP0.4 is a fluorescent protein published in 2006, derived from Clavularia sp.. It is reported to be a monomer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Clavularia sp. 27.5 kDa -

FPbase ID: UEQO7

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mTFP0.4 Sequence

mTFP0.4 was derived from mTFP0.3 with the following mutations: Q104C/C213V
amino acid numbers relative to cFP484. show relative to mTFP0.3

MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTNTVNLEVKEGAPLPFSYDILSNAFCYGNRAFTKYPDDIANYFKQSFPEGYSWERTMTFEDKGIVKVKSDISMEEDSFIYEIRLKGKNFPPNGPVMQKKTLKWEPSTEILYVRDGVLVGDIKHKLLLEGGGHYRVDFKTIYKAKKVVKLPDYHFVDHRIEILNHDKDYNKVTLYENAVARYSLLPPQAGMDELYK

Excerpts

No excerpts have been added for mTFP0.4
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change