compare

Comparison List

You must be logged in to submit a new spectrum

mcFP497

mcFP497 is a fluorescent protein published in 2007, derived from Montastraea cavernosa.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Montastraea cavernosa 25.9 kDa -

FPbase ID: B45Y7

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mcFP497 Sequence

MSVIKSVMKIKLRMDGIVNGHKFMITGEGEGKPFEGTHTIILKVKEGGPLPFAYDILTTAFQYGNRVFTKYPKDIPDYFKQSFPEGYSWERSMTFEDQGVCTVTSDIKLEGDCFFYEIRFYGVNFPSSGPVMQKKTLKWEPSTENMYVRDGVLLGDVSRTLLLEGNKHHRCNFRSTYRAKKGVVLPEYHFVDHRIEILSHDKDYNTVEVYENAVARPSMLPIKAK
GenBank: ABS87206
UniProtKB: A7UAL1
IPG: 13509126

Excerpts

No excerpts have been added for mcFP497
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Dynamic Regulation of Fluorescent Proteins from a Single Species of Coral

Kao H-T, Sturgis S, Desalle R, Tsai J, Davis D, Gruber Df, Pieribone Va

(2007). Marine Biotechnology, 9(6) , 733-746. doi: 10.1007/s10126-007-9025-1. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change