compare

Comparison List

You must be logged in to submit a new spectrum

mc2

mc2 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2003, derived from Montastraea cavernosa.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Montastraea cavernosa 26.0 kDa -

FPbase ID: N2LZL

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
505 515          

Photostability

No photostability measurements available ... add one!

mc2 Sequence

MSVIKPDMKIKLRMEGAVNGHKFVIEGDGKGKPFEGTQSMDLTVKEGAPLPFAYDILTTVFDYGNRVFAKYPQDIPDYFKQTFPEGYSWERSMTYEDQGICVATNDITLMKGVDDCFVYKIRFDGVNFPANGPVMQKKTLKWEPSTEKMYVRDGVLKGDVNMALLLEGGGHYRCDFKTTYKAKKFVQLPDYHFVDHRIEILSHDKDYNKVKLYEHAEAHSGLPRQAK
GenBank: AAO61599
UniProtKB: Q7Z0W8
IPG: 756354

Excerpts

No excerpts have been added for mc2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change